PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN43604.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NF-YA
Protein Properties Length: 335aa    MW: 36505.1 Da    PI: 9.1424
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN43604.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA96.72.6e-30166222158
   CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                 d p+YVNaKQy++I++RRq+Rak+  ++kl +k  kpy+heSRh hA+rRpRgsgGrF
  KHN43604.1 166 DGPIYVNAKQYHGIIRRRQSRAKAVLDHKL-TKRCKPYMHESRHLHAMRRPRGSGGRF 222
                 57****************************.999***********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005215.8E-35164225IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115234.609165225IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.2E-22168190IPR001289Nuclear transcription factor Y subunit A
PfamPF020455.1E-27168222IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.2E-22199222IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MAMQTVYLKK HEGNAHNFVG TLSSAASAPW WSAFGSQSVH QGESCGQMKP FALELPNCID  60
QLAATKLSAR GAEQVLGEGH TTQFTIFPDV SSSDGCKMSD DAQKLQTTIS LQSSLTDPHS  120
RFEIGFSQPM LCAKYPYTDQ FYGLFSAYAP QISGRIMLPL NMSSDDGPIY VNAKQYHGII  180
RRRQSRAKAV LDHKLTKRCK PYMHESRHLH AMRRPRGSGG RFLNTRSSIN GNGKLGNEVH  240
KTVGEQLQSS DSQSSEFLQS EVGTLNSSKE TNGSSPNISG SEVTSMYSRG GLDSFSLNHL  300
GSAVHSFANM IDGGRGMIIP PKWVAAAGNC YNLKV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_A8e-17166223260HAPB protein
4g91_A8e-17166223260HAPB protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0925390.0BT092539.1 Soybean clone JCVI-FLGm-16A23 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006604662.10.0PREDICTED: nuclear transcription factor Y subunit A-10-like isoform X2
RefseqXP_006604661.10.0PREDICTED: nuclear transcription factor Y subunit A-10-like isoform X2
RefseqXP_014626885.10.0PREDICTED: nuclear transcription factor Y subunit A-10-like isoform X2
RefseqXP_006604660.10.0PREDICTED: nuclear transcription factor Y subunit A-10-like isoform X2
RefseqXP_006604659.10.0PREDICTED: nuclear transcription factor Y subunit A-10-like isoform X2
RefseqXP_006604658.10.0PREDICTED: nuclear transcription factor Y subunit A-10-like isoform X2
TrEMBLA0A0B2SH600.0A0A0B2SH60_GLYSO; Nuclear transcription factor Y subunit A-10
STRINGGLYMA19G38800.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37943464
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.21e-52nuclear factor Y, subunit A10
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]